Lineage for d1r3ba1 (1r3b A:18-215)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993280Superfamily a.29.7: Mob1/phocein [101152] (1 family) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 1993281Family a.29.7.1: Mob1/phocein [101153] (2 protein domains)
  6. 1993282Protein Mob1a [101154] (2 species)
  7. 1993283Species African clawed frog (Xenopus laevis) [TaxId:8355] [109796] (1 PDB entry)
    Uniprot Q7T1M9 33-215
  8. 1993284Domain d1r3ba1: 1r3b A:18-215 [104786]
    Other proteins in same PDB: d1r3ba2

Details for d1r3ba1

PDB Entry: 1r3b (more details)

PDB Description: Solution structure of xenopus laevis Mob1
PDB Compounds: (A:) mob1

SCOPe Domain Sequences for d1r3ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ba1 a.29.7.1 (A:18-215) Mob1a {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitef
ctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigv
pfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefnlidr
relaplqelieklgskdr

SCOPe Domain Coordinates for d1r3ba1:

Click to download the PDB-style file with coordinates for d1r3ba1.
(The format of our PDB-style files is described here.)

Timeline for d1r3ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r3ba2