SCOPe 2.08: Domain d1r3ba1: 1r3b A:18-215

Lineage for d1r3ba1 (1r3b A:18-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.7: Mob1/phocein [101152] (2 families)
   common fold is elaborated with additional short helices; contains a zinc-binding site
   automatically mapped to Pfam PF03637

5. Family a.29.7.1: Mob1/phocein [101153] (2 proteins)

6. Protein Mob1a [101154] (2 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [109796] (1 PDB entry)
   Uniprot Q7T1M9 33-215

8. Domain d1r3ba1: 1r3b A:18-215 [104786]
   Other proteins in same PDB: d1r3ba2

Details for d1r3ba1

PDB Entry: 1r3b

PDB Description: solution structure of xenopus laevis mob1

PDB Compounds: (A:) mob1

SCOPe Domain Sequences for d1r3ba1:

Sequence; same for both SEQRES and ATOM records:

>d1r3ba1 a.29.7.1 (A:18-215) Mob1a {African clawed frog (Xenopus laevis) [TaxId: 8355]}
hhhhhhssglvprgsatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitef
ctestcsvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigv
pfpknfmsvaktilkrlfrvyahiyhqhfdavmqlqeeahlntsfkhfiffvqefnlidr
relaplqelieklgskdr

Timeline for d1r3ba1:

• d1r3ba1 first appeared in SCOP 1.69, called d1r3ba_
  
• d1r3ba1 appears in SCOPe 2.07