SCOP 1.69: Domain d1r2va2: 1r2v A:240-307

Lineage for d1r2va2 (1r2v A:240-307)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (4 species)
   secreted during involution

7. Species Sheep (Ovis aries) # [109621] (3 PDB entries)

8. Domain d1r2va2: 1r2v A:240-307 [104785]
   Other proteins in same PDB: d1r2va1

Details for d1r2va2

PDB Entry: 1r2v, 2.07 Å

PDB Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution

SCOP Domain Sequences for d1r2va2:

Sequence; same for both SEQRES and ATOM records:

>d1r2va2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) #}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1r2va2:

• d1r2va2 is new in SCOP 1.69
  
• d1r2va2 appears in SCOP 1.71
  
• d1r2va2 last appears in SCOP 1.73