Lineage for d1r2va1 (1r2v A:1-239,A:308-362)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474902Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 475037Protein Signal processing protein (SPC-40, MGP-40) [89480] (4 species)
    secreted during involution
  7. 475046Species Sheep (Ovis aries) # [109611] (3 PDB entries)
  8. 475047Domain d1r2va1: 1r2v A:1-239,A:308-362 [104784]
    Other proteins in same PDB: d1r2va2

Details for d1r2va1

PDB Entry: 1r2v (more details), 2.07 Å

PDB Description: Crystal structure of a secretory 40kDa glycoprotein from sheep mammary gland at 2.0A resolution

SCOP Domain Sequences for d1r2va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2va1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) #}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

SCOP Domain Coordinates for d1r2va1:

Click to download the PDB-style file with coordinates for d1r2va1.
(The format of our PDB-style files is described here.)

Timeline for d1r2va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r2va2