Lineage for d1r1va_ (1r1v A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306548Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2306555Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species)
  7. 2306556Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries)
    Uniprot O85142
  8. 2306561Domain d1r1va_: 1r1v A: [104775]
    complexed with zn

Details for d1r1va_

PDB Entry: 1r1v (more details), 2.3 Å

PDB Description: Crystal structure of the metal-sensing transcriptional repressor CzrA from Staphylococcus aureus in the Zn2-form
PDB Compounds: (A:) repressor protein

SCOPe Domain Sequences for d1r1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1va_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]}
ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl
vkakrqgqsmiyslddihvatmlkqaihhanhpke

SCOPe Domain Coordinates for d1r1va_:

Click to download the PDB-style file with coordinates for d1r1va_.
(The format of our PDB-style files is described here.)

Timeline for d1r1va_: