![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.5: ArsR-like transcriptional regulators [46801] (5 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Metal-sensing transcriptional repressor CzrA [109664] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [109665] (3 PDB entries) Uniprot O85142 |
![]() | Domain d1r1va_: 1r1v A: [104775] complexed with zn |
PDB Entry: 1r1v (more details), 2.3 Å
SCOPe Domain Sequences for d1r1va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r1va_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} ntdtlervteifkalgdynririmellsvseasvghishqlnlsqsnvshqlkllksvhl vkakrqgqsmiyslddihvatmlkqaihhanhpke
Timeline for d1r1va_: