SCOP 1.69: Domain d1r1sg_: 1r1s G:

Lineage for d1r1sg_ (1r1s G:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (30 proteins)
   Pfam 00017

6. Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)

8. Domain d1r1sg_: 1r1s G: [104768]

Details for d1r1sg_

PDB Entry: 1r1s, 1.9 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads

SCOP Domain Sequences for d1r1sg_:

Sequence; same for both SEQRES and ATOM records:

>d1r1sg_ d.93.1.1 (G:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus)}
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

Timeline for d1r1sg_:

• d1r1sg_ is new in SCOP 1.69
  
• d1r1sg_ appears in SCOP 1.71
  
• d1r1sg_ appears in the current release, SCOPe 2.08, called d1r1sg1