Lineage for d1r1sc_ (1r1s C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2571842Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2571984Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)
  7. 2571985Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
    Uniprot O89100 53-147
  8. 2571993Domain d1r1sc_: 1r1s C: [104766]
    Other proteins in same PDB: d1r1se2, d1r1sg2
    complexed with so4

Details for d1r1sc_

PDB Entry: 1r1s (more details), 1.9 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads
PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d1r1sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1sc_ d.93.1.1 (C:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]}
diefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdt
kgnyflwtekfpslnklvdyyrttsiskqkqvflrd

SCOPe Domain Coordinates for d1r1sc_:

Click to download the PDB-style file with coordinates for d1r1sc_.
(The format of our PDB-style files is described here.)

Timeline for d1r1sc_: