Lineage for d1r1sa_ (1r1s A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608035Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 608036Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 608037Family d.93.1.1: SH2 domain [55551] (31 proteins)
    Pfam 00017
  6. 608153Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)
  7. 608154Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
  8. 608161Domain d1r1sa_: 1r1s A: [104765]

Details for d1r1sa_

PDB Entry: 1r1s (more details), 1.9 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads

SCOP Domain Sequences for d1r1sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1sa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus)}
diefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmrdt
kgnyflwtekfpslnklvdyyrttsiskqkqvflrd

SCOP Domain Coordinates for d1r1sa_:

Click to download the PDB-style file with coordinates for d1r1sa_.
(The format of our PDB-style files is described here.)

Timeline for d1r1sa_: