Lineage for d1r1pc_ (1r1p C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 729820Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)
  7. 729821Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
  8. 729826Domain d1r1pc_: 1r1p C: [104761]

Details for d1r1pc_

PDB Entry: 1r1p (more details), 1.8 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads
PDB Compounds: (C:) GRB2-related adaptor protein 2

SCOP Domain Sequences for d1r1pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1pc_ d.93.1.1 (C:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]}
gsfidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkv
mrdtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

SCOP Domain Coordinates for d1r1pc_:

Click to download the PDB-style file with coordinates for d1r1pc_.
(The format of our PDB-style files is described here.)

Timeline for d1r1pc_: