SCOPe 2.08: Domain d1r1pb1: 1r1p B:52-149

Lineage for d1r1pb1 (1r1p B:52-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein GRB2-related adaptor protein 2 (MONA, GRID) [111086] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [111087] (3 PDB entries)
   Uniprot O89100 53-147

8. Domain d1r1pb1: 1r1p B:52-149 [104760]
   Other proteins in same PDB: d1r1pb2, d1r1pc2
   complexed with so4

Details for d1r1pb1

PDB Entry: 1r1p, 1.8 Å

PDB Description: structural basis for differential recognition of tyrosine phosphorylated sites in the linker for activation of t cells (lat) by the adaptor protein gads

PDB Compounds: (B:) GRB2-related adaptor protein 2

SCOPe Domain Sequences for d1r1pb1:

Sequence; same for both SEQRES and ATOM records:

>d1r1pb1 d.93.1.1 (B:52-149) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]}
fidiefpewfheglsrhqaenllmgkdigffiirasqsspgdfsisvrheddvqhfkvmr
dtkgnyflwtekfpslnklvdyyrttsiskqkqvflrd

Timeline for d1r1pb1:

• d1r1pb1 first appeared in SCOP 1.69, called d1r1pb_
  
• d1r1pb1 appears in SCOPe 2.07