Lineage for d1r0qa_ (1r0q A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690975Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
    Uniprot P04164
  8. 2690978Domain d1r0qa_: 1r0q A: [104755]
    complexed with hfm

Details for d1r0qa_

PDB Entry: 1r0q (more details), 1.61 Å

PDB Description: Characterization of the conversion of the malformed, recombinant cytochrome rc552 to a 2-formyl-4-vinyl (Spirographis) heme
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d1r0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0qa_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
adgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievk
gmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqv
laerkklglk

SCOPe Domain Coordinates for d1r0qa_:

Click to download the PDB-style file with coordinates for d1r0qa_.
(The format of our PDB-style files is described here.)

Timeline for d1r0qa_: