Lineage for d1r0mb2 (1r0m B:6-132)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503550Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 503551Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 503552Family d.54.1.1: Enolase N-terminal domain-like [54827] (10 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 503678Protein N-acylamino acid racemase [110937] (2 species)
  7. 503696Species Deinococcus radiodurans [TaxId:1299] [110939] (1 PDB entry)
  8. 503698Domain d1r0mb2: 1r0m B:6-132 [104750]
    Other proteins in same PDB: d1r0ma1, d1r0mb1, d1r0mc1, d1r0md1

Details for d1r0mb2

PDB Entry: 1r0m (more details), 1.3 Å

PDB Description: Structure of Deinococcus radiodurans N-acylamino acid racemase at 1.3 : insights into a flexible binding pocket and evolution of enzymatic activity

SCOP Domain Sequences for d1r0mb2:

Sequence, based on SEQRES records: (download)

>d1r0mb2 d.54.1.1 (B:6-132) N-acylamino acid racemase {Deinococcus radiodurans}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

Sequence, based on observed residues (ATOM records): (download)

>d1r0mb2 d.54.1.1 (B:6-132) N-acylamino acid racemase {Deinococcus radiodurans}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgg

SCOP Domain Coordinates for d1r0mb2:

Click to download the PDB-style file with coordinates for d1r0mb2.
(The format of our PDB-style files is described here.)

Timeline for d1r0mb2: