Lineage for d1r0mb1 (1r0m B:133-375)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 684589Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 684647Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 684768Protein N-acylamino acid racemase [110372] (4 species)
  7. 684786Species Deinococcus radiodurans [TaxId:1299] [110374] (4 PDB entries)
  8. 684788Domain d1r0mb1: 1r0m B:133-375 [104749]
    Other proteins in same PDB: d1r0ma2, d1r0mb2, d1r0mc2, d1r0md2

Details for d1r0mb1

PDB Entry: 1r0m (more details), 1.3 Å

PDB Description: Structure of Deinococcus radiodurans N-acylamino acid racemase at 1.3 : insights into a flexible binding pocket and evolution of enzymatic activity
PDB Compounds: (B:) N-acylamino acid racemase

SCOP Domain Sequences for d1r0mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0mb1 c.1.11.2 (B:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

SCOP Domain Coordinates for d1r0mb1:

Click to download the PDB-style file with coordinates for d1r0mb1.
(The format of our PDB-style files is described here.)

Timeline for d1r0mb1: