![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
![]() | Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) ![]() |
![]() | Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein) |
![]() | Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species) |
![]() | Species Zymomonas mobilis [TaxId:542] [109891] (2 PDB entries) Uniprot Q9X5F2 |
![]() | Domain d1r0lc1: 1r0l C:291-385 [104741] Other proteins in same PDB: d1r0la2, d1r0la3, d1r0lb2, d1r0lb3, d1r0lc2, d1r0lc3, d1r0ld2, d1r0ld3 complexed with ndp |
PDB Entry: 1r0l (more details), 2.7 Å
SCOPe Domain Sequences for d1r0lc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0lc1 a.69.3.1 (C:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]} klrqmdfeapdyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakiv ektldhytpatpssledvfaidneariqaaalmes
Timeline for d1r0lc1: