Lineage for d1r0lb3 (1r0l B:127-264)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. Species Zymomonas mobilis [TaxId:542] [111051] (2 PDB entries)
    Uniprot Q9X5F2
  8. Domain d1r0lb3: 1r0l B:127-264 [104740]
    Other proteins in same PDB: d1r0la1, d1r0la2, d1r0lb1, d1r0lb2, d1r0lc1, d1r0lc2, d1r0ld1, d1r0ld2
    complexed with ndp

Details for d1r0lb3

PDB Entry: 1r0l (more details), 2.7 Å

PDB Description: 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with nadph
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1r0lb3:

Sequence, based on SEQRES records: (download)

>d1r0lb3 d.81.1.3 (B:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
slvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrttsla
ematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilvhpqsvi
hsmveyldgsilaqigsp

Sequence, based on observed residues (ATOM records): (download)

>d1r0lb3 d.81.1.3 (B:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
slvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrttsla
ematvtperavqhpakisidsatmmnkglelieafhlfqiplekfeilvhpqsvihsmve
yldgsilaqigsp

SCOPe Domain Coordinates for d1r0lb3 are not available.

Timeline for d1r0lb3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r0lb1, d1r0lb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1r0la1, d1r0la2, d1r0la3, d1r0lc1, d1r0lc2, d1r0lc3, d1r0ld1, d1r0ld2, d1r0ld3