SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1r0la2 (1r0l A:3-126,A:265-290)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2092282Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 protein domains)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2092283Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 2092310Species Zymomonas mobilis [TaxId:542] [110420] (2 PDB entries)
    Uniprot Q9X5F2
  8. 2092315Domain d1r0la2: 1r0l A:3-126,A:265-290 [104736]
    Other proteins in same PDB: d1r0la1, d1r0la3, d1r0lb1, d1r0lb3, d1r0lc1, d1r0lc3, d1r0ld1, d1r0ld3
    complexed with ndp

Details for d1r0la2

PDB Entry: 1r0l (more details), 2.7 Å

PDB Description: 1-deoxy-D-xylulose 5-phosphate reductoisomerase from zymomonas mobilis in complex with NADPH
PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1r0la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0la2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp
slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval
ankeXdmrtpightlawpkrmetpaesldft

SCOPe Domain Coordinates for d1r0la2:

Click to download the PDB-style file with coordinates for d1r0la2.
(The format of our PDB-style files is described here.)

Timeline for d1r0la2: