Lineage for d1r0kc3 (1r0k C:127-264)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527526Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 2527527Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 2527550Species Zymomonas mobilis [TaxId:542] [111051] (2 PDB entries)
    Uniprot Q9X5F2
  8. 2527553Domain d1r0kc3: 1r0k C:127-264 [104731]
    Other proteins in same PDB: d1r0ka1, d1r0ka2, d1r0kb1, d1r0kb2, d1r0kc1, d1r0kc2, d1r0kd1, d1r0kd2
    complexed with act

Details for d1r0kc3

PDB Entry: 1r0k (more details), 1.91 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
PDB Compounds: (C:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1r0kc3:

Sequence, based on SEQRES records: (download)

>d1r0kc3 d.81.1.3 (C:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
slvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrttsla
ematvtperavqhpnwsmgakisidsatmmnkglelieafhlfqiplekfeilvhpqsvi
hsmveyldgsilaqigsp

Sequence, based on observed residues (ATOM records): (download)

>d1r0kc3 d.81.1.3 (C:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
slvsagglmidavrehgttllpvdsehnaifqcfphhnrdyvrriiitasggpfrttsla
ematvtperavgakisidsatmmnkglelieafhlfqiplekfeilvhpqsvihsmveyl
dgsilaqigsp

SCOPe Domain Coordinates for d1r0kc3:

Click to download the PDB-style file with coordinates for d1r0kc3.
(The format of our PDB-style files is described here.)

Timeline for d1r0kc3: