Lineage for d1r0kc1 (1r0k C:291-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717707Superfamily a.69.3: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69055] (1 family) (S)
  5. 2717708Family a.69.3.1: 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69056] (1 protein)
  6. 2717709Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain [69057] (2 species)
  7. 2717732Species Zymomonas mobilis [TaxId:542] [109891] (2 PDB entries)
    Uniprot Q9X5F2
  8. 2717735Domain d1r0kc1: 1r0k C:291-385 [104729]
    Other proteins in same PDB: d1r0ka2, d1r0ka3, d1r0kb2, d1r0kb3, d1r0kc2, d1r0kc3, d1r0kd2, d1r0kd3
    complexed with act

Details for d1r0kc1

PDB Entry: 1r0k (more details), 1.91 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
PDB Compounds: (C:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1r0kc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0kc1 a.69.3.1 (C:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]}
klrqmdfeapdyerfpaltlamesiksggarpavmnaaneiavaafldkkigfldiakiv
ektldhytpatpssledvfaidneariqaaalmes

SCOPe Domain Coordinates for d1r0kc1:

Click to download the PDB-style file with coordinates for d1r0kc1.
(The format of our PDB-style files is described here.)

Timeline for d1r0kc1: