![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.216: I/LWEQ domain [109884] (1 superfamily) 5 helices; bundle, closed, left-handed twist |
![]() | Superfamily a.216.1: I/LWEQ domain [109885] (1 family) ![]() |
![]() | Family a.216.1.1: I/LWEQ domain [109886] (2 proteins) Pfam PF01608 actin-binding motif that adopts different folds; possibly refolds upon binding |
![]() | Protein Huntingtin interacting protein 12 [109887] (1 species) Hip1r thatch domain core |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109888] (1 PDB entry) Uniprot O75146 773-965 |
![]() | Domain d1r0di_: 1r0d I: [104722] |
PDB Entry: 1r0d (more details), 1.9 Å
SCOPe Domain Sequences for d1r0di_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0di_ a.216.1.1 (I:) Huntingtin interacting protein 12 {Human (Homo sapiens) [TaxId: 9606]} dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas tksgqeqiedrdtm
Timeline for d1r0di_: