SCOPe 2.07: Domain d1r0dh_: 1r0d H:

Lineage for d1r0dh_ (1r0d H:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.216: I/LWEQ domain [109884] (1 superfamily)
   5 helices; bundle, closed, left-handed twist

4. Superfamily a.216.1: I/LWEQ domain [109885] (1 family)

5. Family a.216.1.1: I/LWEQ domain [109886] (2 proteins)
   Pfam PF01608
   actin-binding motif that adopts different folds; possibly refolds upon binding

6. Protein Huntingtin interacting protein 12 [109887] (1 species)
   Hip1r thatch domain core

7. Species Human (Homo sapiens) [TaxId:9606] [109888] (1 PDB entry)
   Uniprot O75146 773-965

8. Domain d1r0dh_: 1r0d H: [104721]

Details for d1r0dh_

PDB Entry: 1r0d, 1.9 Å

PDB Description: hip1r thatch domain core

PDB Compounds: (H:) Huntingtin Interacting Protein 12

SCOPe Domain Sequences for d1r0dh_:

Sequence; same for both SEQRES and ATOM records:

>d1r0dh_ a.216.1.1 (H:) Huntingtin interacting protein 12 {Human (Homo sapiens) [TaxId: 9606]}
dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
tksgqeqied

Timeline for d1r0dh_:

• d1r0dh_ first appeared in SCOP 1.69
  
• d1r0dh_ appears in SCOPe 2.06
  
• d1r0dh_ appears in the current release, SCOPe 2.08