Lineage for d1r0da_ (1r0d A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737695Fold a.216: I/LWEQ domain [109884] (1 superfamily)
    5 helices; bundle, closed, left-handed twist
  4. 2737696Superfamily a.216.1: I/LWEQ domain [109885] (1 family) (S)
  5. 2737697Family a.216.1.1: I/LWEQ domain [109886] (2 proteins)
    Pfam PF01608
    actin-binding motif that adopts different folds; possibly refolds upon binding
  6. 2737698Protein Huntingtin interacting protein 12 [109887] (1 species)
    Hip1r thatch domain core
  7. 2737699Species Human (Homo sapiens) [TaxId:9606] [109888] (1 PDB entry)
    Uniprot O75146 773-965
  8. 2737700Domain d1r0da_: 1r0d A: [104715]

Details for d1r0da_

PDB Entry: 1r0d (more details), 1.9 Å

PDB Description: hip1r thatch domain core
PDB Compounds: (A:) Huntingtin Interacting Protein 12

SCOPe Domain Sequences for d1r0da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0da_ a.216.1.1 (A:) Huntingtin interacting protein 12 {Human (Homo sapiens) [TaxId: 9606]}
dvrqeelgavvdkemaatsaaiedavrriedmmnqarhassgvklevnerilnsctdlmk
airllvttstslqkeivesgrgaatqqefyaknsrwteglisaskavgwgatqlveaadk
vvlhtgkyeelivcsheiaastaqlvaaskvkankhsphlsrlqecsrtvneraanvvas
tksgqeqiedrdtm

SCOPe Domain Coordinates for d1r0da_:

Click to download the PDB-style file with coordinates for d1r0da_.
(The format of our PDB-style files is described here.)

Timeline for d1r0da_: