Lineage for d1r0ch2 (1r0c H:101-153)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966286Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1966287Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 1966288Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 1966289Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 1966339Domain d1r0ch2: 1r0c H:101-153 [104714]
    Other proteins in same PDB: d1r0ca1, d1r0ca2, d1r0cb1, d1r0cg1, d1r0cg2, d1r0ch1
    complexed with ncd, po4, zn

Details for d1r0ch2

PDB Entry: 1r0c (more details), 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme
PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1r0ch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ch2 g.41.7.1 (H:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1r0ch2:

Click to download the PDB-style file with coordinates for d1r0ch2.
(The format of our PDB-style files is described here.)

Timeline for d1r0ch2: