Lineage for d1r0ch1 (1r0c H:1-100)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504113Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 504114Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 504115Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 504118Species Escherichia coli [TaxId:562] [54896] (33 PDB entries)
  8. 504142Domain d1r0ch1: 1r0c H:1-100 [104713]
    Other proteins in same PDB: d1r0ca1, d1r0ca2, d1r0cb2, d1r0cg1, d1r0cg2, d1r0ch2

Details for d1r0ch1

PDB Entry: 1r0c (more details), 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme

SCOP Domain Sequences for d1r0ch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ch1 d.58.2.1 (H:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1r0ch1:

Click to download the PDB-style file with coordinates for d1r0ch1.
(The format of our PDB-style files is described here.)

Timeline for d1r0ch1: