Lineage for d1r0cg2 (1r0c G:151-310)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906434Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2906435Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2906443Species Escherichia coli [TaxId:562] [53674] (62 PDB entries)
    Uniprot P00479
  8. 2906507Domain d1r0cg2: 1r0c G:151-310 [104712]
    Other proteins in same PDB: d1r0cb1, d1r0cb2, d1r0ch1, d1r0ch2
    complexed with ncd, po4, zn

Details for d1r0cg2

PDB Entry: 1r0c (more details), 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme
PDB Compounds: (G:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1r0cg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0cg2 c.78.1.1 (G:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d1r0cg2:

Click to download the PDB-style file with coordinates for d1r0cg2.
(The format of our PDB-style files is described here.)

Timeline for d1r0cg2: