Lineage for d1r0cb1 (1r0c B:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723615Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family) (S)
  5. 723616Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 723617Protein Aspartate carbamoyltransferase [54895] (2 species)
  7. 723621Species Escherichia coli [TaxId:562] [54896] (41 PDB entries)
  8. 723656Domain d1r0cb1: 1r0c B:1-100 [104709]
    Other proteins in same PDB: d1r0ca1, d1r0ca2, d1r0cb2, d1r0cg1, d1r0cg2, d1r0ch2

Details for d1r0cb1

PDB Entry: 1r0c (more details), 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOP Domain Sequences for d1r0cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0cb1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOP Domain Coordinates for d1r0cb1:

Click to download the PDB-style file with coordinates for d1r0cb1.
(The format of our PDB-style files is described here.)

Timeline for d1r0cb1: