SCOP 1.69: Domain d1r0ca1: 1r0c A:1-150

Lineage for d1r0ca1 (1r0c A:1-150)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)

8. Domain d1r0ca1: 1r0c A:1-150 [104707]
   Other proteins in same PDB: d1r0cb1, d1r0cb2, d1r0ch1, d1r0ch2

Details for d1r0ca1

PDB Entry: 1r0c, 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme

SCOP Domain Sequences for d1r0ca1:

Sequence; same for both SEQRES and ATOM records:

>d1r0ca1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

Timeline for d1r0ca1:

• d1r0ca1 is new in SCOP 1.69
  
• d1r0ca1 appears in SCOP 1.71
  
• d1r0ca1 appears in the current release, SCOPe 2.08