SCOPe 2.06: Domain d1r0bl2: 1r0b L:101-153

Lineage for d1r0bl2 (1r0b L:101-153)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
   Uniprot P00478

8. Domain d1r0bl2: 1r0b L:101-153 [104706]
   Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg1, d1r0bh1, d1r0bi1, d1r0bj1, d1r0bk1, d1r0bl1
   complexed with flc, po4, zn

Details for d1r0bl2

PDB Entry: 1r0b, 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate

PDB Compounds: (L:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1r0bl2:

Sequence; same for both SEQRES and ATOM records:

>d1r0bl2 g.41.7.1 (L:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1r0bl2:

• d1r0bl2 first appeared in SCOP 1.69
  
• d1r0bl2 appears in SCOPe 2.05
  
• d1r0bl2 appears in SCOPe 2.07
  
• d1r0bl2 appears in the current release, SCOPe 2.08