Lineage for d1r0bi2 (1r0b I:101-153)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587937Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 2587938Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)
  6. 2587939Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)
  7. 2587940Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
    Uniprot P00478
  8. 2588053Domain d1r0bi2: 1r0b I:101-153 [104700]
    Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg1, d1r0bh1, d1r0bi1, d1r0bj1, d1r0bk1, d1r0bl1
    complexed with flc, po4, zn

Details for d1r0bi2

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate
PDB Compounds: (I:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1r0bi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bi2 g.41.7.1 (I:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

SCOPe Domain Coordinates for d1r0bi2:

Click to download the PDB-style file with coordinates for d1r0bi2.
(The format of our PDB-style files is described here.)

Timeline for d1r0bi2: