Lineage for d1r0bh1 (1r0b H:1-100)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. Species Escherichia coli [TaxId:562] [54896] (62 PDB entries)
    Uniprot P00478
  8. Domain d1r0bh1: 1r0b H:1-100 [104697]
    Other proteins in same PDB: d1r0ba1, d1r0ba2, d1r0bb1, d1r0bb2, d1r0bc1, d1r0bc2, d1r0bd1, d1r0bd2, d1r0be1, d1r0be2, d1r0bf1, d1r0bf2, d1r0bg2, d1r0bh2, d1r0bi2, d1r0bj2, d1r0bk2, d1r0bl2
    complexed with flc, po4, zn

Details for d1r0bh1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate
PDB Compounds: (H:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d1r0bh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bh1 d.58.2.1 (H:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d1r0bh1 are not available.

Timeline for d1r0bh1:

Domains from same chain:
(mouse over for more information)
d1r0bh2