Lineage for d1r0bf1 (1r0b F:1-150)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493140Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 493141Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 493142Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 493143Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 493157Species Escherichia coli [TaxId:562] [53674] (36 PDB entries)
  8. 493310Domain d1r0bf1: 1r0b F:1-150 [104693]
    Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2

Details for d1r0bf1

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: Aspartate Transcarbamylase (ATCase) of Escherichia coli: A New Crystalline R State Bound to PALA, or to Product Analogues Phosphate and Citrate

SCOP Domain Sequences for d1r0bf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0bf1 c.78.1.1 (F:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d1r0bf1:

Click to download the PDB-style file with coordinates for d1r0bf1.
(The format of our PDB-style files is described here.)

Timeline for d1r0bf1: