Lineage for d1r0be2 (1r0b E:151-310)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2513851Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2513859Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2514097Domain d1r0be2: 1r0b E:151-310 [104692]
    Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2
    complexed with flc, po4, zn

Details for d1r0be2

PDB Entry: 1r0b (more details), 2.9 Å

PDB Description: aspartate transcarbamylase (atcase) of escherichia coli: a new crystalline r state bound to pala, or to product analogues phosphate and citrate
PDB Compounds: (E:) Aspartate carbamoyltransferase catalytic chain

SCOPe Domain Sequences for d1r0be2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0be2 c.78.1.1 (E:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

SCOPe Domain Coordinates for d1r0be2:

Click to download the PDB-style file with coordinates for d1r0be2.
(The format of our PDB-style files is described here.)

Timeline for d1r0be2: