![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
![]() | Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
![]() | Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [53674] (62 PDB entries) Uniprot P00479 |
![]() | Domain d1r0be2: 1r0b E:151-310 [104692] Other proteins in same PDB: d1r0bg1, d1r0bg2, d1r0bh1, d1r0bh2, d1r0bi1, d1r0bi2, d1r0bj1, d1r0bj2, d1r0bk1, d1r0bk2, d1r0bl1, d1r0bl2 complexed with flc, po4, zn |
PDB Entry: 1r0b (more details), 2.9 Å
SCOPe Domain Sequences for d1r0be2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0be2 c.78.1.1 (E:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv deiatdvdktphawyfqqagngifarqallalvlnrdlvl
Timeline for d1r0be2: