Lineage for d1r0ah2 (1r0a H:124-225)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655698Domain d1r0ah2: 1r0a H:124-225 [104680]
    Other proteins in same PDB: d1r0aa1, d1r0aa2, d1r0ab1, d1r0ah1, d1r0al1, d1r0al2
    complexed with 2da, glc, gol, mg

Details for d1r0ah2

PDB Entry: 1r0a (more details), 2.8 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase covalently tethered to DNA template-primer solved to 2.8 angstroms
PDB Compounds: (H:) monoclonal antibody (heavy chain)

SCOP Domain Sequences for d1r0ah2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ah2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

SCOP Domain Coordinates for d1r0ah2:

Click to download the PDB-style file with coordinates for d1r0ah2.
(The format of our PDB-style files is described here.)

Timeline for d1r0ah2: