![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
![]() | Domain d1r0ah2: 1r0a H:124-225 [104680] Other proteins in same PDB: d1r0aa1, d1r0aa2, d1r0ab1, d1r0ah1, d1r0al1, d1r0al2 complexed with 2da, glc, gol, mg |
PDB Entry: 1r0a (more details), 2.8 Å
SCOP Domain Sequences for d1r0ah2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0ah2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc
Timeline for d1r0ah2: