SCOP 1.71: Domain d1r0ah2: 1r0a H:124-225

Lineage for d1r0ah2 (1r0a H:124-225)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1r0ah2: 1r0a H:124-225 [104680]
   Other proteins in same PDB: d1r0aa1, d1r0aa2, d1r0ab1, d1r0ah1, d1r0al1, d1r0al2
   complexed with 2da, glc, gol, mg

Details for d1r0ah2

PDB Entry: 1r0a, 2.8 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase covalently tethered to DNA template-primer solved to 2.8 angstroms

SCOP Domain Sequences for d1r0ah2:

Sequence; same for both SEQRES and ATOM records:

>d1r0ah2 b.1.1.2 (H:124-225) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpadc

Timeline for d1r0ah2:

• d1r0ah2 first appeared in SCOP 1.69
  
• d1r0ah2 appears in SCOP 1.73
  
• d1r0ah2 appears in the current release, SCOPe 2.07