Lineage for d1r0ah1 (1r0a H:1-123)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652858Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
  8. 652866Domain d1r0ah1: 1r0a H:1-123 [104679]
    Other proteins in same PDB: d1r0aa1, d1r0aa2, d1r0ab1, d1r0ah2, d1r0al1, d1r0al2
    complexed with 2da, glc, gol, mg

Details for d1r0ah1

PDB Entry: 1r0a (more details), 2.8 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase covalently tethered to DNA template-primer solved to 2.8 angstroms
PDB Compounds: (H:) monoclonal antibody (heavy chain)

SCOP Domain Sequences for d1r0ah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOP Domain Coordinates for d1r0ah1:

Click to download the PDB-style file with coordinates for d1r0ah1.
(The format of our PDB-style files is described here.)

Timeline for d1r0ah1: