Lineage for d1r0ab1 (1r0a B:1-429)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3016821Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 3016822Protein HIV-1 reverse transcriptase [56689] (4 species)
  7. 3016866Species Human immunodeficiency virus type 1 [TaxId:11676] [56690] (206 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 3017097Domain d1r0ab1: 1r0a B:1-429 [104678]
    Other proteins in same PDB: d1r0aa1, d1r0ah1, d1r0ah2, d1r0al1, d1r0al2
    protein/DNA complex; complexed with glc, gol, mg

Details for d1r0ab1

PDB Entry: 1r0a (more details), 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase covalently tethered to dna template-primer solved to 2.8 angstroms
PDB Compounds: (B:) reverse transcriptase

SCOPe Domain Sequences for d1r0ab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ab1 e.8.1.2 (B:1-429) HIV-1 reverse transcriptase {Human immunodeficiency virus type 1 [TaxId: 11676]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfkkqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d1r0ab1:

Click to download the PDB-style file with coordinates for d1r0ab1.
(The format of our PDB-style files is described here.)

Timeline for d1r0ab1: