![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
![]() | Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries) |
![]() | Domain d1r0aa1: 1r0a A:430-558 [104676] Other proteins in same PDB: d1r0aa2, d1r0ab1, d1r0ah1, d1r0ah2, d1r0al1, d1r0al2 |
PDB Entry: 1r0a (more details), 2.8 Å
SCOP Domain Sequences for d1r0aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0aa1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagirk
Timeline for d1r0aa1: