Lineage for d1r03a_ (1r03 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314153Protein (Apo)ferritin [47246] (8 species)
  7. 2314567Species Human (Homo sapiens), mitocondial isoform [TaxId:9606] [109785] (1 PDB entry)
    Uniprot Q8N4E7
  8. 2314568Domain d1r03a_: 1r03 A: [104675]
    complexed with mg

Details for d1r03a_

PDB Entry: 1r03 (more details), 1.7 Å

PDB Description: crystal structure of a human mitochondrial ferritin
PDB Compounds: (A:) mitochondrial ferritin

SCOPe Domain Sequences for d1r03a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]}
srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg
dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg

SCOPe Domain Coordinates for d1r03a_:

Click to download the PDB-style file with coordinates for d1r03a_.
(The format of our PDB-style files is described here.)

Timeline for d1r03a_: