SCOPe 2.01: Domain d1r03a_: 1r03 A:

Lineage for d1r03a_ (1r03 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Human (Homo sapiens), mitocondial isoform [TaxId:9606] [109785] (1 PDB entry)
   Uniprot Q8N4E7

8. Domain d1r03a_: 1r03 A: [104675]
   complexed with mg

Details for d1r03a_

PDB Entry: 1r03, 1.7 Å

PDB Description: crystal structure of a human mitochondrial ferritin

PDB Compounds: (A:) mitochondrial ferritin

SCOPe Domain Sequences for d1r03a_:

Sequence; same for both SEQRES and ATOM records:

>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]}
srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg
dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg

Timeline for d1r03a_:

• d1r03a_ first appeared in SCOP 1.69
  
• d1r03a_ appears in SCOP 1.75
  
• d1r03a_ appears in SCOPe 2.02
  
• d1r03a_ appears in the current release, SCOPe 2.08