SCOP 1.69: Domain d1r03a_: 1r03 A:

Lineage for d1r03a_ (1r03 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein (Apo)ferritin [47246] (5 species)

7. Species Human (Homo sapiens), mitocondial isoform [TaxId:9606] [109785] (1 PDB entry)

8. Domain d1r03a_: 1r03 A: [104675]

Details for d1r03a_

PDB Entry: 1r03, 1.7 Å

PDB Description: crystal structure of a human mitochondrial ferritin

SCOP Domain Sequences for d1r03a_:

Sequence; same for both SEQRES and ATOM records:

>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform}
srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg
dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg

Timeline for d1r03a_:

• d1r03a_ is new in SCOP 1.69
  
• d1r03a_ appears in SCOP 1.71
  
• d1r03a_ appears in the current release, SCOPe 2.08