Lineage for d1qztc_ (1qzt C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906218Family c.77.1.5: Phosphotransacetylase [102663] (3 proteins)
    Pfam PF01515; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PdxA-like and PlsX-like families
  6. 2906222Protein Phosphotransacetylase Pta [110717] (3 species)
  7. 2906236Species Methanosarcina thermophila [TaxId:2210] [110718] (3 PDB entries)
    Uniprot P38503
  8. 2906243Domain d1qztc_: 1qzt C: [104672]
    complexed with so4

Details for d1qztc_

PDB Entry: 1qzt (more details), 2.7 Å

PDB Description: phosphotransacetylase from methanosarcina thermophila
PDB Compounds: (C:) Phosphate acetyltransferase

SCOPe Domain Sequences for d1qztc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qztc_ c.77.1.5 (C:) Phosphotransacetylase Pta {Methanosarcina thermophila [TaxId: 2210]}
vtflekiserakklnktialpetedirtlqaaakilergiadivlvgneadikalagdld
lskakivdpktyekkdeyinafyelrkhkgitlenaaeimsdyvyfavmmaklgevdgvv
sgaahsssdtlrpavqivktakgaalasaffiisvpdceygsdgtflfadsgmvempsve
dvaniavisaktfellvqdvpkvamlsystkgsaksklteatiastklaqelapdiaidg
elqvdaaivpkvaaskapgspvagkanvfifpdlncgniaykiaqrlakaeaygpitqgl
akpindlsrgcsdedivgavaitcvqaaaqd

SCOPe Domain Coordinates for d1qztc_:

Click to download the PDB-style file with coordinates for d1qztc_.
(The format of our PDB-style files is described here.)

Timeline for d1qztc_: