Lineage for d1qz2c2 (1qz2 C:145-257)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720427Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 720515Protein FKBP52, N-terminal domains [82619] (1 species)
  7. 720516Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
  8. 720526Domain d1qz2c2: 1qz2 C:145-257 [104668]
    Other proteins in same PDB: d1qz2a1, d1qz2b1, d1qz2c1
    second FKPB domain

Details for d1qz2c2

PDB Entry: 1qz2 (more details), 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90
PDB Compounds: (C:) FK506-binding protein 4

SCOP Domain Sequences for d1qz2c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz2c2 d.26.1.1 (C:145-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

SCOP Domain Coordinates for d1qz2c2:

Click to download the PDB-style file with coordinates for d1qz2c2.
(The format of our PDB-style files is described here.)

Timeline for d1qz2c2: