Lineage for d1qz2c1 (1qz2 C:258-425)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726664Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)
  7. 2726665Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
    Uniprot Q02790 145-427
  8. 2726671Domain d1qz2c1: 1qz2 C:258-425 [104667]
    Other proteins in same PDB: d1qz2a2, d1qz2a3, d1qz2b2, d1qz2b3, d1qz2c2, d1qz2c3
    second FKPB domain

Details for d1qz2c1

PDB Entry: 1qz2 (more details), 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90
PDB Compounds: (C:) FK506-binding protein 4

SCOPe Domain Sequences for d1qz2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz2c1 a.118.8.1 (C:258-425) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka

SCOPe Domain Coordinates for d1qz2c1:

Click to download the PDB-style file with coordinates for d1qz2c1.
(The format of our PDB-style files is described here.)

Timeline for d1qz2c1: