SCOPe 2.01: Domain d1qz2b1: 1qz2 B:258-425

Lineage for d1qz2b1 (1qz2 B:258-425)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
   Uniprot Q02790 145-427

8. Domain d1qz2b1: 1qz2 B:258-425 [104665]
   Other proteins in same PDB: d1qz2a2, d1qz2b2, d1qz2c2
   second FKPB domain

Details for d1qz2b1

PDB Entry: 1qz2, 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90

PDB Compounds: (B:) FK506-binding protein 4

SCOPe Domain Sequences for d1qz2b1:

Sequence; same for both SEQRES and ATOM records:

>d1qz2b1 a.118.8.1 (B:258-425) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka

Timeline for d1qz2b1:

• d1qz2b1 first appeared in SCOP 1.69
  
• d1qz2b1 appears in SCOP 1.75
  
• d1qz2b1 appears in SCOPe 2.02
  
• d1qz2b1 appears in the current release, SCOPe 2.08