Lineage for d1qz2b1 (1qz2 B:258-425)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647285Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (17 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 647295Protein FKBP52 (FKBP4), C-terminal domain [109971] (1 species)
  7. 647296Species Human (Homo sapiens) [TaxId:9606] [109972] (2 PDB entries)
  8. 647301Domain d1qz2b1: 1qz2 B:258-425 [104665]
    Other proteins in same PDB: d1qz2a2, d1qz2b2, d1qz2c2

Details for d1qz2b1

PDB Entry: 1qz2 (more details), 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90
PDB Compounds: (B:) FK506-binding protein 4

SCOP Domain Sequences for d1qz2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz2b1 a.118.8.1 (B:258-425) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
swemnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqal
rlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfq
kvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka

SCOP Domain Coordinates for d1qz2b1:

Click to download the PDB-style file with coordinates for d1qz2b1.
(The format of our PDB-style files is described here.)

Timeline for d1qz2b1: