Lineage for d1qyza_ (1qyz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304369Protein Cytochrome c552 [46636] (6 species)
  7. 2304431Species Thermus thermophilus [TaxId:274] [46637] (7 PDB entries)
    Uniprot P04164
  8. 2304433Domain d1qyza_: 1qyz A: [104662]
    complexed with hco

Details for d1qyza_

PDB Entry: 1qyz (more details), 1.4 Å

PDB Description: Characterization of the malformed, recombinant cytochrome rC552
PDB Compounds: (A:) Cytochrome c-552

SCOPe Domain Sequences for d1qyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyza_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus [TaxId: 274]}
adgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievk
gmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqv
laerkklglk

SCOPe Domain Coordinates for d1qyza_:

Click to download the PDB-style file with coordinates for d1qyza_.
(The format of our PDB-style files is described here.)

Timeline for d1qyza_: