Lineage for d1qyza_ (1qyz A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437748Protein Cytochrome c552 [46636] (5 species)
  7. 437775Species Thermus thermophilus [TaxId:274] [46637] (5 PDB entries)
  8. 437777Domain d1qyza_: 1qyz A: [104662]

Details for d1qyza_

PDB Entry: 1qyz (more details), 1.4 Å

PDB Description: Characterization of the malformed, recombinant cytochrome rC552

SCOP Domain Sequences for d1qyza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyza_ a.3.1.1 (A:) Cytochrome c552 {Thermus thermophilus}
adgakiyaqcagchqqngqgipgafpplaghvaeilakeggreylilvllyglqgqievk
gmkyngvmssfaqlkdeeiaavlnhiatawgdakkvkgfkpftaeevkklrakkltpqqv
laerkklglk

SCOP Domain Coordinates for d1qyza_:

Click to download the PDB-style file with coordinates for d1qyza_.
(The format of our PDB-style files is described here.)

Timeline for d1qyza_: