Lineage for d1qyxa_ (1qyx A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477209Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (45 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 477565Protein Human estrogenic 17beta-hydroxysteroid dehydrogenase [51772] (1 species)
  7. 477566Species Human (Homo sapiens) [TaxId:9606] [51773] (16 PDB entries)
  8. 477571Domain d1qyxa_: 1qyx A: [104661]

Details for d1qyxa_

PDB Entry: 1qyx (more details), 1.89 Å

PDB Description: crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstenedione and nadp

SCOP Domain Sequences for d1qyxa_:

Sequence, based on SEQRES records: (download)

>d1qyxa_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens)}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevfg

Sequence, based on observed residues (ATOM records): (download)

>d1qyxa_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens)}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalrapk
ptlryftterflpllrmrlddpsgsnyvtamhrevfg

SCOP Domain Coordinates for d1qyxa_:

Click to download the PDB-style file with coordinates for d1qyxa_.
(The format of our PDB-style files is described here.)

Timeline for d1qyxa_: