Lineage for d1qywa_ (1qyw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091485Protein Human estrogenic 17beta-hydroxysteroid dehydrogenase [51772] (1 species)
  7. 2091486Species Human (Homo sapiens) [TaxId:9606] [51773] (22 PDB entries)
    Uniprot P14061
  8. 2091489Domain d1qywa_: 1qyw A: [104660]
    complexed with 5sd, gol, nap

Details for d1qywa_

PDB Entry: 1qyw (more details), 1.63 Å

PDB Description: crystal structure of human estrogenic 17beta-hydroxysteroid dehydrogenase complex with androstanedione and nadp
PDB Compounds: (A:) Estradiol 17 beta-dehydrogenase 1

SCOPe Domain Sequences for d1qywa_:

Sequence, based on SEQRES records: (download)

>d1qywa_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtafmekvlgspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevf
ltalrapkptlryftterflpllrmrlddpsgsnyvtamhrevf

Sequence, based on observed residues (ATOM records): (download)

>d1qywa_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
artvvlitgcssgiglhlavrlasdpsqsfkvyatlrdlktqgrlweaaralacppgsle
tlqldvrdsksvaaarervtegrvdvlvcnaglgllgplealgedavasvldvnvvgtvr
mlqaflpdmkrrgsgrvlvtgsvgglmglpfndvycaskfaleglceslavlllpfgvhl
sliecgpvhtspeevldrtdihtfhrfyqylahskqvfreaaqnpeevaevfltalrapk
ptlryftterflpllrmrlddpsgsnyvtamhrevf

SCOPe Domain Coordinates for d1qywa_:

Click to download the PDB-style file with coordinates for d1qywa_.
(The format of our PDB-style files is described here.)

Timeline for d1qywa_: