Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.2: PhzC/PhzF-like [89863] (4 proteins) Pfam PF02567 |
Protein Hypothetical protein YddE [89864] (1 species) |
Species Escherichia coli [TaxId:562] [89865] (4 PDB entries) Uniprot P37757 structural genomics; NESG target ET25 |
Domain d1qyab1: 1qya B:2-129 [104655] Other proteins in same PDB: d1qyaa3, d1qyab3 Structural genomics target |
PDB Entry: 1qya (more details), 2 Å
SCOPe Domain Sequences for d1qyab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qyab1 d.21.1.2 (B:2-129) Hypothetical protein YddE {Escherichia coli [TaxId: 562]} kpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvrir yftptvevpicghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqg tpgfeppl
Timeline for d1qyab1: